PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G2870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 482aa    MW: 53876.1 Da    PI: 7.5653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G2870genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-134592148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed  l+ +v+++G g+W+++ +  g+ R++k+c++rw ++l
      Gh_D11G2870 45 KGPWTATEDAVLAGYVRRHGEGNWNAVRKNTGLARCGKSCRLRWANHL 92
                     79******************************************9986 PP

2Myb_DNA-binding48.91.5e-1598141146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ +++++++++G++ W++ a  ++ gRt++++k++w++
      Gh_D11G2870  98 KGSFSPEEERIIIELHAKMGNR-WARMATQLP-GRTDNEIKNYWNT 141
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.3994092IPR017930Myb domain
SMARTSM007179.2E-104494IPR001005SANT/Myb domain
SuperFamilySSF466892.62E-2844139IPR009057Homeodomain-like
PfamPF002499.2E-134592IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-224699IPR009057Homeodomain-like
CDDcd001671.75E-84792No hitNo description
PROSITE profilePS5129425.72893147IPR017930Myb domain
SMARTSM007171.3E-1697145IPR001005SANT/Myb domain
PfamPF002491.2E-1498141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-25100146IPR009057Homeodomain-like
CDDcd001675.30E-12100141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MMMMMMMREN NQFAAQNEGG GSLGNNGRNN GGVGVGREGE IVLKKGPWTA TEDAVLAGYV  60
RRHGEGNWNA VRKNTGLARC GKSCRLRWAN HLRPNLKKGS FSPEEERIII ELHAKMGNRW  120
ARMATQLPGR TDNEIKNYWN TRVKRRQRQG LPLYPPDVQP HYSEHQHRQR HSHPSSPIPS  180
PPPTTEPNSC FSFQTPIVSP HTSNPMPLHP LHIPHRPPPQ NFLYNPHSAL TTPPPPLQSP  240
NSASAPAPLP SPNASTPPHI SPLYSPHNPP PFPTLPLFDY PNITTDDDFF HSNKRFKHDG  300
LQSNNYYNNH LDATSSSFTL PFSPMQHYSN GMTLDLPSSS RTAFNQDSGC FYPLKTDLRS  360
NQINDDGMLE NILQEARELA ANGRGGNKEM PKEMMNSAQN EEEDYSRLIN IDGLSSLGMA  420
IPEWCNDSGE SSERQPSVIT DNENHLALDM HQIASLYPAD ISPNHAARSS SVRSWDKFPG  480
LC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30431465107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6162604e-80JX616260.1 Gossypium hirsutum clone NBRI_GE60774 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434369.10.0PREDICTED: myb-like protein A
TrEMBLA0A0D2PHT80.0A0A0D2PHT8_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51002747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.13e-69myb domain protein 101